Pop drop · Free shipping over $55 · Squiggle sale

RPL7L1 Antibody - Cat. #: CSB-PA020316GA01HU Viral RNA Isolation Kits Protein Names:Recommended name: Mannose permease

SKU 95019751041
4.1
USD416.14 USD447.14

Pay in 4 interest-free payments of $104.03 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Description

Protein Names:Recommended name: Mannose permease IIC component Alternative name(s): EII-P-Man EIIC-Man PTS system mannose-specific EIIC component

Immunogen:Synthesized peptide derived from human CD54

GRS2 antibody

AA Sequence: PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

RPL7L1 Antibody - Cat. #: CSB-PA020316GA01HU Viral RNA Isolation Kits Protein Names:Recommended name: Mannose permeaseSize : 50ul Clone Number: Aliases: RPL7L1 antibody; 60S ribosomal protein L7 like 1 antibody; Large ribosomal subunit protein uL30 like 1 antibody Product Type: Polyclonal Antibody Immunogen Species: Homo sapiens (Human) UniProt ID: Q6DKI1 Immunogen: Human RPL7L1 Raised in: Rabbit Species Reactivity: Human, Mouse, Rat Tested Applications: ELISA, WB, IHC, IF Background: Clonality: Polyclonal Isotype: IgG Purification Method: Antigen Affinity purified

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products